PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100148180081
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family G2-like
Protein Properties Length: 337aa    MW: 37218 Da    PI: 7.2224
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100148180081genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1071e-332377155
                       G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                                  kprlrWt eLHerFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQk+Rl
  Ote100148180081|100148180081 23 KPRLRWTVELHERFVDAVTQLGGPDKATPKTIMRVMGVKGLTLYHLKSHLQKFRL 77
                                  79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.3472080IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.0E-322078IPR009057Homeodomain-like
SuperFamilySSF466891.49E-162278IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-232378IPR006447Myb domain, plants
PfamPF002491.0E-72575IPR001005SANT/Myb domain
PfamPF143791.1E-25119166IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010088Biological Processphloem development
GO:0010089Biological Processxylem development
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MNSHERPMCV QGDSGLVLTT DPKPRLRWTV ELHERFVDAV TQLGGPDKAT PKTIMRVMGV  60
KGLTLYHLKS HLQKFRLGKQ PHKDFNDHSM KDASSLDLQR SNASSSGMMG RSMNDGNNVH  120
ITDAIRMQME VNRRLHEQLE VQRHLQLRIE AHGKYMQTIL EKACQTVLAG ENIAAASGSY  180
NKAAATGPGP GPDISGLKEF GPTLNFPSLQ DLNIYGSSDQ LDHLHHQNME RSSMEAFMPT  240
ADNFIGKKKP NPYNNNSSGK SPLIWADDLR LQELGTATSA SCLDDTQIQI GPLSIDRGGE  300
IDSVSDIYET KPILSGDHSI GDKKFEGSAK MDRCSPR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011095765.10.0PREDICTED: myb family transcription factor APL isoform X2
SwissprotQ9SAK51e-109APL_ARATH; Myb family transcription factor APL
TrEMBLW9R1F01e-162W9R1F0_9R
STRINGVIT_19s0085g00890.t011e-155(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA79422231